Brand: | Abnova |
Reference: | H00003578-M01 |
Product name: | IL9 monoclonal antibody (M01), clone 1C9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL9. |
Clone: | 1C9 |
Isotype: | IgG1 Kappa |
Gene id: | 3578 |
Gene name: | IL9 |
Gene alias: | HP40|IL-9|P40 |
Gene description: | interleukin 9 |
Genbank accession: | NM_000590.1 |
Immunogen: | IL9 (NP_000581.1, 18 a.a. ~ 144 a.a) full-length recombinant protein. |
Immunogen sequence/protein sequence: | MQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
Protein accession: | NP_000581.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |