| Brand: | Abnova |
| Reference: | H00003578-M01 |
| Product name: | IL9 monoclonal antibody (M01), clone 1C9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL9. |
| Clone: | 1C9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3578 |
| Gene name: | IL9 |
| Gene alias: | HP40|IL-9|P40 |
| Gene description: | interleukin 9 |
| Genbank accession: | NM_000590.1 |
| Immunogen: | IL9 (NP_000581.1, 18 a.a. ~ 144 a.a) full-length recombinant protein. |
| Immunogen sequence/protein sequence: | MQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
| Protein accession: | NP_000581.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |