| Brand: | Abnova |
| Reference: | H00003576-M22 |
| Product name: | IL8 monoclonal antibody (M22), clone 2A8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant IL8. |
| Clone: | 2A8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3576 |
| Gene name: | IL8 |
| Gene alias: | CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1 |
| Gene description: | interleukin 8 |
| Genbank accession: | BC013615 |
| Immunogen: | IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein. |
| Immunogen sequence/protein sequence: | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Protein accession: | AAH13615 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.69 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IL8 monoclonal antibody, clone 4G11 ( Cat # H00003576-M22 ) . Western Blot detection against a 8.9 KDa biologically active recombinant human IL-8 ( endothelial-derived ). |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |