Cart 17 Product Products 5 961,35 € (empty)
-
-
-
1 x α-tubulin...259,07 € -
-
1 x β III...259,07 € -
-
-
-
-
-
1 x Survivin...259,07 € -
-
1 x Acetyl...259,07 € -
1 x α-tubulin...259,07 € -
-
-
No products
To be determined Shipping
5 961,35 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 961,35 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 961,35 €
Data sheet of IL8 monoclonal antibody (M18), clone 4E3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,IP |
More info about IL8 monoclonal antibody (M18), clone 4E3
| Brand: | Abnova |
| Reference: | H00003576-M18 |
| Product name: | IL8 monoclonal antibody (M18), clone 4E3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant IL8. |
| Clone: | 4E3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3576 |
| Gene name: | IL8 |
| Gene alias: | CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1 |
| Gene description: | interleukin 8 |
| Genbank accession: | BC013615 |
| Immunogen: | IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein. |
| Immunogen sequence/protein sequence: | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Protein accession: | AAH13615 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.69 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of IL8 transfected lysate using anti-IL8 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IL8 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |