Brand: | Abnova |
Reference: | H00003576-M16 |
Product name: | IL8 monoclonal antibody (M16), clone 1B4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant IL8. |
Clone: | 1B4 |
Isotype: | IgG2a Kappa |
Gene id: | 3576 |
Gene name: | IL8 |
Gene alias: | CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1 |
Gene description: | interleukin 8 |
Genbank accession: | BC013615 |
Immunogen: | IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein. |
Immunogen sequence/protein sequence: | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Protein accession: | AAH13615 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.69 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | IL8 monoclonal antibody, clone 4G11 ( Cat # H00003576-M16 ) . Western Blot detection against a 8.9 KDa biologically active recombinant human IL-8 ( endothelial-derived ). |
Applications: | ELISA,IP,WB-Re |
Shipping condition: | Dry Ice |