Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL8 monoclonal antibody (M12), clone 4G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,IP,WB-Re |
More info about IL8 monoclonal antibody (M12), clone 4G11
| Brand: | Abnova |
| Reference: | H00003576-M12 |
| Product name: | IL8 monoclonal antibody (M12), clone 4G11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant IL8. |
| Clone: | 4G11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3576 |
| Gene name: | IL8 |
| Gene alias: | CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1 |
| Gene description: | interleukin 8 |
| Genbank accession: | BC013615 |
| Immunogen: | IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein. |
| Immunogen sequence/protein sequence: | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Protein accession: | AAH13615 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.69 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IL8 monoclonal antibody, clone 4G11 ( Cat # H00003576-M12 ) . Western Blot detection against a 8.9 KDa biologically active recombinant human IL-8 ( endothelial-derived ). |
| Applications: | ELISA,IP,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Randomised clinical trial: the analgesic properties of dietary supplementation with palmitoylethanolamide and polydatin in irritable bowel syndrome.Cremon C, Stanghellini V, Barbaro MR, Cogliandro RF, Bellacosa L, Santos J, Vicario M, Pigrau M, Alonso Cotoner C, Lobo B, Azpiroz F, Bruley des Varannes S, Neunlist M, DeFilippis D, Iuvone T, Petrosino S, Di Marzo V, Barbara G. Aliment Pharmacol Ther. 2017 Apr;45(7):909-922. doi: 10.1111/apt.13958. Epub 2017 Feb 6. |