IL8 monoclonal antibody (M09), clone 2F12 View larger

IL8 monoclonal antibody (M09), clone 2F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL8 monoclonal antibody (M09), clone 2F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IL8 monoclonal antibody (M09), clone 2F12

Brand: Abnova
Reference: H00003576-M09
Product name: IL8 monoclonal antibody (M09), clone 2F12
Product description: Mouse monoclonal antibody raised against a partial recombinant IL8.
Clone: 2F12
Isotype: IgG2a Kappa
Gene id: 3576
Gene name: IL8
Gene alias: CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1
Gene description: interleukin 8
Genbank accession: BC013615.1
Immunogen: IL8 (AAH13615.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Protein accession: AAH13615.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003576-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.32 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003576-M09-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged IL8 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL8 monoclonal antibody (M09), clone 2F12 now

Add to cart