| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00003569-M02 |
| Product name: | IL6 monoclonal antibody (M02), clone 2D12 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL6. |
| Clone: | 2D12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3569 |
| Gene name: | IL6 |
| Gene alias: | BSF2|HGF|HSF|IFNB2|IL-6 |
| Gene description: | interleukin 6 (interferon, beta 2) |
| Genbank accession: | NM_000600 |
| Immunogen: | IL6 (NP_000591, 29 a.a.-212 a.a.) full-length recombinant protein. |
| Immunogen sequence/protein sequence: | SPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Protein accession: | NP_000591 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of IL6 expression in transfected 293T cell line by IL6 monoclonal antibody (M02), clone 2D12. Lane 1: IL6 transfected lysate(23.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |