No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00003569-D03P |
Product name: | IL6 purified MaxPab rabbit polyclonal antibody (D03P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human IL6 protein. |
Gene id: | 3569 |
Gene name: | IL6 |
Gene alias: | BSF2|HGF|HSF|IFNB2|IL-6 |
Gene description: | interleukin 6 (interferon, beta 2) |
Genbank accession: | BC015511.1 |
Immunogen: | IL6 (AAH15511, 1 a.a. ~ 212 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Protein accession: | AAH15511 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of IL6 expression in transfected 293T cell line (H00003569-T01) by IL6 MaxPab polyclonal antibody. Lane 1: IL6 transfected lysate(23.32 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |