IL6 purified MaxPab rabbit polyclonal antibody (D03P) View larger

IL6 purified MaxPab rabbit polyclonal antibody (D03P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL6 purified MaxPab rabbit polyclonal antibody (D03P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about IL6 purified MaxPab rabbit polyclonal antibody (D03P)

Brand: Abnova
Reference: H00003569-D03P
Product name: IL6 purified MaxPab rabbit polyclonal antibody (D03P)
Product description: Rabbit polyclonal antibody raised against a full-length human IL6 protein.
Gene id: 3569
Gene name: IL6
Gene alias: BSF2|HGF|HSF|IFNB2|IL-6
Gene description: interleukin 6 (interferon, beta 2)
Genbank accession: BC015511.1
Immunogen: IL6 (AAH15511, 1 a.a. ~ 212 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Protein accession: AAH15511
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003569-D03P-13-15-1.jpg
Application image note: Western Blot analysis of IL6 expression in transfected 293T cell line (H00003569-T01) by IL6 MaxPab polyclonal antibody.

Lane 1: IL6 transfected lysate(23.32 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL6 purified MaxPab rabbit polyclonal antibody (D03P) now

Add to cart