Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL6 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about IL6 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00003569-B01P |
| Product name: | IL6 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human IL6 protein. |
| Gene id: | 3569 |
| Gene name: | IL6 |
| Gene alias: | BSF2|HGF|HSF|IFNB2|IL-6 |
| Gene description: | interleukin 6 (interferon, beta 2) |
| Genbank accession: | BC015511 |
| Immunogen: | IL6 (AAH15511, 1 a.a. ~ 212 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Protein accession: | AAH15511 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of IL6 expression in transfected 293T cell line (H00003569-T01) by IL6 MaxPab polyclonal antibody. Lane 1: IL6 transfected lysate(23.32 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Cancer-associated fibroblasts affect breast cancer cell gene expression, invasion and angiogenesis.Eiro N, Gonzalez L, Martinez-Ordonez A, Fernandez-Garcia B, Gonzalez LO, Cid S, Dominguez F, Perez-Fernandez R, Vizoso FJ. Cell Oncol (Dordr). 2018 Mar 1. [Epub ahead of print] |