Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL3RA (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about IL3RA (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00003563-Q01 |
| Product name: | IL3RA (Human) Recombinant Protein (Q01) |
| Product description: | Human IL3RA partial ORF ( NP_002174, 19 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 3563 |
| Gene name: | IL3RA |
| Gene alias: | CD123|IL3R|IL3RAY|IL3RX|IL3RY|MGC34174|hIL-3Ra |
| Gene description: | interleukin 3 receptor, alpha (low affinity) |
| Genbank accession: | NM_002183 |
| Immunogen sequence/protein sequence: | TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAEN |
| Protein accession: | NP_002174 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |