View larger

IL3RA (Human) Recombinant Protein

Reference:

Condition: New product

Data sheet of IL3RA (Human) Recombinant Protein

Brand:	Abnova
Reference:	H00003563-H01
Product name:	IL3RA (Human) Recombinant Protein
Product description:	Purified IL3RA (NP_002174.1, 19 a.a. - 305 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Gene id:	3563
Gene name:	IL3RA
Gene alias:	CD123\|IL3R\|IL3RAY\|IL3RX\|IL3RY\|MGC34174\|hIL-3Ra
Gene description:	interleukin 3 receptor, alpha (low affinity)
Genbank accession:	NM_002183.2
Immunogen sequence/protein sequence:	TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
Protein accession:	NP_002174.1
Form:	Liquid
Concentration:	â‰¥ 10 ug/ml
Host cell:	Human HEK293H cells
Preparation method:	Transfection of pSuper-IL3RA plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
Storage buffer:	100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	SDS-PAGE and Western Blot
Quality control testing picture:
Tag:	His-Flag-StrepII
Product type:	Proteins
Host species:	Human
Antigen species / target species:	Human
Applications:	WB,ELISA,SDS-PAGE,PI
Shipping condition:	Dry Ice