View larger

IL1RN (Human) Recombinant Protein (P01)

Reference:

Condition: New product

Data sheet of IL1RN (Human) Recombinant Protein (P01)

Brand:	Abnova
Reference:	H00003557-P01
Product name:	IL1RN (Human) Recombinant Protein (P01)
Product description:	Human IL1RN full-length ORF ( AAH09745, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	3557
Gene name:	IL1RN
Gene alias:	ICIL-1RA\|IL-1ra3\|IL1F3\|IL1RA\|IRAP\|MGC10430
Gene description:	interleukin 1 receptor antagonist
Genbank accession:	BC009745
Immunogen sequence/protein sequence:	MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Protein accession:	AAH09745
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Interleukin-1 alpha blockade prevents hyperkeratosis in an in vitro model of lamellar ichthyosis.O'Shaughnessy RF, Choudhary I, Harper JI. Hum Mol Genet. 2010 Apr 27. [Epub ahead of print]