No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00003557-M03 |
| Product name: | IL1RN monoclonal antibody (M03), clone 1H5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL1RN. |
| Clone: | 1H5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3557 |
| Gene name: | IL1RN |
| Gene alias: | ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430 |
| Gene description: | interleukin 1 receptor antagonist |
| Genbank accession: | BC009745 |
| Immunogen: | IL1RN (AAH09745, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
| Protein accession: | AAH09745 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged IL1RN is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |