| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00003557-B01P |
| Product name: | IL1RN purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human IL1RN protein. |
| Gene id: | 3557 |
| Gene name: | IL1RN |
| Gene alias: | ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430 |
| Gene description: | interleukin 1 receptor antagonist |
| Genbank accession: | NM_173842 |
| Immunogen: | IL1RN (NP_776214.1, 1 a.a. ~ 177 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
| Protein accession: | NP_776214.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of IL1RN expression in transfected 293T cell line (H00003557-T02) by IL1RN MaxPab polyclonal antibody. Lane 1: IL1RN transfected lysate(20.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |