| Brand: | Abnova |
| Reference: | H00003552-M03 |
| Product name: | IL1A monoclonal antibody (M03), clone 4C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL1A. |
| Clone: | 4C6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3552 |
| Gene name: | IL1A |
| Gene alias: | IL-1A|IL1|IL1-ALPHA|IL1F1 |
| Gene description: | interleukin 1, alpha |
| Genbank accession: | BC013142 |
| Immunogen: | IL1A (AAH13142, 172 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
| Protein accession: | AAH13142 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged IL1A is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |