| Brand: | Abnova |
| Reference: | H00003551-M08 |
| Product name: | IKBKB monoclonal antibody (M08), clone 3C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IKBKB. |
| Clone: | 3C12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3551 |
| Gene name: | IKBKB |
| Gene alias: | FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB |
| Gene description: | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta |
| Genbank accession: | BC006231 |
| Immunogen: | IKBKB (AAH06231, 3 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG |
| Protein accession: | AAH06231 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged IKBKB is approximately 0.3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |