| Brand: | Abnova |
| Reference: | H00003551-A01 |
| Product name: | IKBKB polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant IKBKB. |
| Gene id: | 3551 |
| Gene name: | IKBKB |
| Gene alias: | FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB |
| Gene description: | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta |
| Genbank accession: | BC006231 |
| Immunogen: | IKBKB (AAH06231.1, 1 a.a. ~ 256 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS |
| Protein accession: | AAH06231.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |