Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IHH monoclonal antibody (M02), clone 3A10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about IHH monoclonal antibody (M02), clone 3A10
| Brand: | Abnova |
| Reference: | H00003549-M02 |
| Product name: | IHH monoclonal antibody (M02), clone 3A10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant IHH. |
| Clone: | 3A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3549 |
| Gene name: | IHH |
| Gene alias: | BDA1|HHG2 |
| Gene description: | Indian hedgehog homolog (Drosophila) |
| Genbank accession: | BC034757 |
| Immunogen: | IHH (AAH34757, 119 a.a. ~ 217 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPG |
| Protein accession: | AAH34757 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |