Brand: | Abnova |
Reference: | H00003549-M01 |
Product name: | IHH monoclonal antibody (M01), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant IHH. |
Clone: | 2G9 |
Isotype: | IgG2a Kappa |
Gene id: | 3549 |
Gene name: | IHH |
Gene alias: | BDA1|HHG2 |
Gene description: | Indian hedgehog homolog (Drosophila) |
Genbank accession: | BC034757 |
Immunogen: | IHH (AAH34757, 119 a.a. ~ 217 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPG |
Protein accession: | AAH34757 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | IHH monoclonal antibody (M01), clone 2G9 Western Blot analysis of IHH expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |
Publications: | Protease nexin 1 inhibits hedgehog signaling in prostate adenocarcinoma.McKee CM, Xu D, Cao Y, Kabraji S, Allen D, Kersemans V, Beech J, Smart S, Hamdy F, Ishkanian A, Sykes J, Pintile M, Milosevic M, van der Kwast T, Zafarana G, Ramnarine VR, Jurisica I, Mallof C, Lam W, Bristow RG, Muschel RJ. J Clin Invest. 2012 Nov 1;122(11):4025-36. doi: 10.1172/JCI59348. Epub 2012 Oct 8. |