| Brand: | Abnova |
| Reference: | H00003547-M01 |
| Product name: | IGSF1 monoclonal antibody (M01), clone 4C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IGSF1. |
| Clone: | 4C7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3547 |
| Gene name: | IGSF1 |
| Gene alias: | IGCD1|IGDC1|INHBP|KIAA0364|MGC75490|PGSF2 |
| Gene description: | immunoglobulin superfamily, member 1 |
| Genbank accession: | NM_001555 |
| Immunogen: | IGSF1 (NP_001546, 220 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VVAGLYPKPTLTAHPGPIMAPGESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLSD |
| Protein accession: | NP_001546 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | IGSF1 monoclonal antibody (M01), clone 4C7. Western Blot analysis of IGSF1 expression in rat brain. |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |