| Brand: | Abnova |
| Reference: | H00003516-M01 |
| Product name: | RBPJ monoclonal antibody (M01), clone 4E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RBPJ. |
| Clone: | 4E12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3516 |
| Gene name: | RBPJ |
| Gene alias: | CBF1|IGKJRB|IGKJRB1|KBF2|MGC61669|RBP-J|RBPJK|RBPSUH|SUH|csl |
| Gene description: | recombination signal binding protein for immunoglobulin kappa J region |
| Genbank accession: | NM_203284 |
| Immunogen: | RBPJ (NP_976029, 3 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | WIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYC |
| Protein accession: | NP_976029 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RBPJ monoclonal antibody (M01), clone 4E12 Western Blot analysis of RBPJ expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |