Cart 88 Product Products 24 530,85 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 88 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 24 530,85 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 24 795,85 €
Data sheet of IGHG3 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about IGHG3 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00003502-B01P |
| Product name: | IGHG3 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human IGHG3 protein. |
| Gene id: | 3502 |
| Gene name: | IGHG3 |
| Gene alias: | DKFZp686H11213|FLJ39988|FLJ40036|FLJ40253|FLJ40587|FLJ40789|FLJ40834|IgG3|MGC45809 |
| Gene description: | immunoglobulin heavy constant gamma 3 (G3m marker) |
| Genbank accession: | BC033178 |
| Immunogen: | IGHG3 (AAH33178.1, 1 a.a. ~ 521 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEFGLSWVLLVVFLQGVQCEVQLVDSGGGLVQPGGSLRLSCAASGFIVSDHYVEWVRQAPGKGPEWVGCFRSKAHKSTTEYAASVKGRFTILRDDSKNSVHLQMNSLKTDDTAVYYCVRDLEGAGKYDWYFDIWGRGILVTVSSASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK |
| Protein accession: | AAH33178.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of IGHG3 expression in transfected 293T cell line (H00003502-T01) by IGHG3 MaxPab polyclonal antibody. Lane 1: IGHG3 transfected lysate(57.31 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |