Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IGHG1 MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IF,WB-Tr,IP |
More info about IGHG1 MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00003500-D01 |
| Product name: | IGHG1 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human IGHG1 protein. |
| Gene id: | 3500 |
| Gene name: | IGHG1 |
| Gene alias: | - |
| Gene description: | immunoglobulin heavy constant gamma 1 (G1m marker) |
| Genbank accession: | BC092518 |
| Immunogen: | IGHG1 (AAH92518.1, 1 a.a. ~ 469 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEFGLSWVFLVAILKGVQCEVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCATRGGYSTAGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Protein accession: | AAH92518.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of IGHG1 transfected lysate using anti-IGHG1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IGHG1 purified MaxPab mouse polyclonal antibody (B01P) (H00003500-B01P). |
| Applications: | IF,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | New Insight into Benign Tumours of Major Salivary Glands by Proteomic Approach.Donadio E, Giusti L, Seccia V, Ciregia F, da Valle Y, Dallan I, Ventroni T, Giannaccini G, Sellari-Franceschini S, Lucacchini A. PLoS One. 2013 Aug 26;8(8):e71874. |