Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IGF1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about IGF1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003479-A01 |
| Product name: | IGF1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IGF1. |
| Gene id: | 3479 |
| Gene name: | IGF1 |
| Gene alias: | IGFI |
| Gene description: | insulin-like growth factor 1 (somatomedin C) |
| Genbank accession: | NM_000618 |
| Immunogen: | IGF1 (NP_000609, 49 a.a. ~ 138 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSRDLRRLEMYCAPLKPTKSARSVRAQRHTDMPKTQKEVHL |
| Protein accession: | NP_000609 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Stable interference of EWS-VFLI1 in an Ewing sarcoma cell line impairs IGF-1/IGF-1R signalling and reveals TOPK as a new target.Herrero-Martin D, Osuna D, Ordonez JL, Sevillano V, Martins AS, Mackintosh C, Campos M, Madoz-Gurpide J, Otero-Motta AP, Caballero G, Amaral AT, Wai DH, Braun Y, Eisenacher M, Schaefer KL, Poremba C, de Alava E. Br J Cancer. 2009 Jul 7;101(1):80-90. Epub 2009 Jun 2. |