| Brand: | Abnova |
| Reference: | H00003476-A01 |
| Product name: | IGBP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IGBP1. |
| Gene id: | 3476 |
| Gene name: | IGBP1 |
| Gene alias: | ALPHA-4|IBP1 |
| Gene description: | immunoglobulin (CD79A) binding protein 1 |
| Genbank accession: | NM_001551 |
| Immunogen: | IGBP1 (NP_001542, 64 a.a. ~ 165 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQK |
| Protein accession: | NP_001542 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IGBP1 polyclonal antibody (A01), Lot # 050914JC01 Western Blot analysis of IGBP1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |