Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IFNG MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about IFNG MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00003458-B01 |
| Product name: | IFNG MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human IFNG protein. |
| Gene id: | 3458 |
| Gene name: | IFNG |
| Gene alias: | IFG|IFI |
| Gene description: | interferon, gamma |
| Genbank accession: | NM_000619 |
| Immunogen: | IFNG (NP_000610, 1 a.a. ~ 166 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ |
| Protein accession: | NP_000610 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of IFNG expression in transfected 293T cell line (H00003458-T02) by IFNG MaxPab polyclonal antibody. Lane 1: IFNG transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Targeting a Newly Established Spontaneous Feline Fibrosarcoma Cell Line by Gene Transfer.Nande R, Di Benedetto A, Aimola P, De Carlo F, Carper M, Claudio CD, Denvir J, Valluri J, Duncan GC, Claudio PP. PLoS One. 2012;7(5):e37743. Epub 2012 May 30. |