Brand: | Abnova |
Reference: | H00003452-D01 |
Product name: | IFNA21 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human IFNA21 protein. |
Gene id: | 3452 |
Gene name: | IFNA21 |
Gene alias: | MGC126687|MGC126689 |
Gene description: | interferon, alpha 21 |
Genbank accession: | BC069329.1 |
Immunogen: | IFNA21 (AAH69329.1, 1 a.a. ~ 189 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE |
Protein accession: | AAH69329.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of IFNA21 transfected lysate using anti-IFNA21 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IFNA21 MaxPab mouse polyclonal antibody (B01) (H00003452-B01). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |