Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00003448-D01P |
Product name: | IFNA14 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human IFNA14 protein. |
Gene id: | 3448 |
Gene name: | IFNA14 |
Gene alias: | LEIF2H|MGC125756|MGC125757 |
Gene description: | interferon, alpha 14 |
Genbank accession: | BC074956 |
Immunogen: | IFNA14 (AAH74956.1, 1 a.a. ~ 189 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
Protein accession: | AAH74956.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of IFNA14 expression in transfected 293T cell line (H00003448-T02) by IFNA14 MaxPab polyclonal antibody. Lane 1: IFNA14 transfected lysate(22.10 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |