| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00003440-M37 |
| Product name: | IFNA2 monoclonal antibody (M37), clone 2D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNA2. |
| Clone: | 2D6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3440 |
| Gene name: | IFNA2 |
| Gene alias: | IFNA|INFA2|MGC125764|MGC125765 |
| Gene description: | interferon, alpha 2 |
| Genbank accession: | NM_000605 |
| Immunogen: | IFNA2 (NP_000596, 24 a.a. ~ 188 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Protein accession: | NP_000596 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (19.2 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of IFNA2 expression in transfected 293T cell line by IFNA2 monoclonal antibody (M37), clone 2D6. Lane 1: IFNA2 transfected lysate(21.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |