IFNA2 monoclonal antibody (M10), clone 3A3 View larger

IFNA2 monoclonal antibody (M10), clone 3A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFNA2 monoclonal antibody (M10), clone 3A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about IFNA2 monoclonal antibody (M10), clone 3A3

Brand: Abnova
Reference: H00003440-M10
Product name: IFNA2 monoclonal antibody (M10), clone 3A3
Product description: Mouse monoclonal antibody raised against a partial recombinant IFNA2.
Clone: 3A3
Isotype: IgG2a Kappa
Gene id: 3440
Gene name: IFNA2
Gene alias: IFNA|INFA2|MGC125764|MGC125765
Gene description: interferon, alpha 2
Genbank accession: NM_000605
Immunogen: IFNA2 (NP_000596, 24 a.a. ~ 188 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Protein accession: NP_000596
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003440-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (85.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003440-M10-13-15-1.jpg
Application image note: Western Blot analysis of IFNA2 expression in transfected 293T cell line by IFNA2 monoclonal antibody.

Lane 1: IFNA2 transfected lysate(21.6 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IFNA2 monoclonal antibody (M10), clone 3A3 now

Add to cart