| Brand: | Abnova |
| Reference: | H00003431-M03 |
| Product name: | SP110 monoclonal antibody (M03), clone 2G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SP110. |
| Clone: | 2G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3431 |
| Gene name: | SP110 |
| Gene alias: | FLJ22835|IFI41|IFI75|IPR1|VODI |
| Gene description: | SP110 nuclear body protein |
| Genbank accession: | NM_004510 |
| Immunogen: | SP110 (NP_004501, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS |
| Protein accession: | NP_004501 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SP110 monoclonal antibody (M03), clone 2G10 Western Blot analysis of SP110 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |