| Brand: | Abnova |
| Reference: | H00003430-M01 |
| Product name: | IFI35 monoclonal antibody (M01), clone 3H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IFI35. |
| Clone: | 3H6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3430 |
| Gene name: | IFI35 |
| Gene alias: | FLJ21753|IFP35 |
| Gene description: | interferon-induced protein 35 |
| Genbank accession: | NM_005533 |
| Immunogen: | IFI35 (NP_005524, 189 a.a. ~ 288 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG |
| Protein accession: | NP_005524 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IFI35 monoclonal antibody (M01), clone 3H6 Western Blot analysis of IFI35 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of Interferon-{alpha} induced genes associated with antiviral activity in Daudi cells, and characterization of IFIT3 as a novel antiviral gene.Schmeisser H, Mejido J, Balinsky CA, Morrow AN, Clark CR, Zhao T, Zoon KC. J Virol. 2010 Aug 4. [Epub ahead of print] |