Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IFI27 monoclonal antibody (M01), clone 4B8-G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about IFI27 monoclonal antibody (M01), clone 4B8-G2
| Brand: | Abnova |
| Reference: | H00003429-M01 |
| Product name: | IFI27 monoclonal antibody (M01), clone 4B8-G2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant IFI27. |
| Clone: | 4B8-G2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3429 |
| Gene name: | IFI27 |
| Gene alias: | FAM14D|ISG12|ISG12A|P27 |
| Gene description: | interferon, alpha-inducible protein 27 |
| Genbank accession: | BC015492 |
| Immunogen: | IFI27 (AAH15492, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY |
| Protein accession: | AAH15492 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged IFI27 is approximately 30ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |