No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00003429-D01P |
| Product name: | IFI27 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human IFI27 protein. |
| Gene id: | 3429 |
| Gene name: | IFI27 |
| Gene alias: | FAM14D|ISG12|ISG12A|P27 |
| Gene description: | interferon, alpha-inducible protein 27 |
| Genbank accession: | NM_005532.3 |
| Immunogen: | IFI27 (NP_005523.3, 1 a.a. ~ 119 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY |
| Protein accession: | NP_005523.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of IFI27 expression in transfected 293T cell line (H00003429-T02) by IFI27 MaxPab polyclonal antibody. Lane 1: IFI27 transfected lysate(11.30 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | IFI27, a novel epidermal growth factor-stabilized protein, is functionally involved in proliferation and cell cycling of human epidermal keratinocytes.Hsieh WL, Huang YH, Wang TM, Ming YC, Tsai CN, Pang JH Cell Prolif. 2015 Apr;48(2):187-197. doi: 10.1111/cpr.12168. Epub 2015 Feb 9. |