Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IDS polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about IDS polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003423-A01 |
| Product name: | IDS polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IDS. |
| Gene id: | 3423 |
| Gene name: | IDS |
| Gene alias: | MPS2|SIDS |
| Gene description: | iduronate 2-sulfatase |
| Genbank accession: | NM_000202 |
| Immunogen: | IDS (NP_000193, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVF |
| Protein accession: | NP_000193 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | In Vitro recapitulation of the site-specific editing (to Wild-Type) of mutant IDS mRNA transcripts, and characterization of IDS protein translated from the edited mRNAs.Lualdi S, Zotto GD, Zegarra-Moran O, Pedemonte N, Corsolini F, Bruschi M, Tomati V, Amico G, Candiano G, Dardis A, Cooper DN, Filocamo M. Hum Mutat. 2017 Jul;38(7):849-862. doi: 10.1002/humu.23243. Epub 2017 May 22. |