IDI1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

IDI1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IDI1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about IDI1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003422-D01P
Product name: IDI1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human IDI1 protein.
Gene id: 3422
Gene name: IDI1
Gene alias: IPP1|IPPI1
Gene description: isopentenyl-diphosphate delta isomerase 1
Genbank accession: BC057827.1
Immunogen: IDI1 (AAH57827.1, 1 a.a. ~ 228 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
Protein accession: AAH57827.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003422-D01P-1-19-1.jpg
Application image note: IDI1 MaxPab rabbit polyclonal antibody. Western Blot analysis of IDI1 expression in IMR-32.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IDI1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart