Brand: | Abnova |
Reference: | H00003422-A02 |
Product name: | IDI1 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant IDI1. |
Gene id: | 3422 |
Gene name: | IDI1 |
Gene alias: | IPP1|IPPI1 |
Gene description: | isopentenyl-diphosphate delta isomerase 1 |
Genbank accession: | BC005247.1 |
Immunogen: | IDI1 (AAH05247.1, 1 a.a. ~ 228 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM |
Protein accession: | AAH05247.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (51.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |