IDI1 polyclonal antibody (A01) View larger

IDI1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IDI1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about IDI1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003422-A01
Product name: IDI1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant IDI1.
Gene id: 3422
Gene name: IDI1
Gene alias: IPP1|IPPI1
Gene description: isopentenyl-diphosphate delta isomerase 1
Genbank accession: NM_004508
Immunogen: IDI1 (NP_004499, 175 a.a. ~ 283 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: IPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYR
Protein accession: NP_004499
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003422-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IDI1 polyclonal antibody (A01) now

Add to cart