| Brand: | Abnova |
| Reference: | H00003420-M01 |
| Product name: | IDH3B monoclonal antibody (M01), clone 3A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IDH3B. |
| Clone: | 3A10 |
| Isotype: | IgG3 Kappa |
| Gene id: | 3420 |
| Gene name: | IDH3B |
| Gene alias: | FLJ11043|H-IDHB|MGC903 |
| Gene description: | isocitrate dehydrogenase 3 (NAD+) beta |
| Genbank accession: | NM_006899 |
| Immunogen: | IDH3B (NP_008830, 296 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKG |
| Protein accession: | NP_008830 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged IDH3B is approximately 10ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |