IDH3B purified MaxPab rabbit polyclonal antibody (D01P) View larger

IDH3B purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IDH3B purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about IDH3B purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003420-D01P
Product name: IDH3B purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human IDH3B protein.
Gene id: 3420
Gene name: IDH3B
Gene alias: FLJ11043|H-IDHB|MGC903
Gene description: isocitrate dehydrogenase 3 (NAD+) beta
Genbank accession: NM_006899.2
Immunogen: IDH3B (NP_008830.2, 1 a.a. ~ 385 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
Protein accession: NP_008830.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003420-D01P-13-15-1.jpg
Application image note: Western Blot analysis of IDH3B expression in transfected 293T cell line (H00003420-T01) by IDH3B MaxPab polyclonal antibody.

Lane 1: IDH3B transfected lysate(42.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IDH3B purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart