Brand: | Abnova |
Reference: | H00003416-A01 |
Product name: | IDE polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant IDE. |
Gene id: | 3416 |
Gene name: | IDE |
Gene alias: | FLJ35968|INSULYSIN |
Gene description: | insulin-degrading enzyme |
Genbank accession: | NM_004969 |
Immunogen: | IDE (NP_004960, 920 a.a. ~ 1019 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL |
Protein accession: | NP_004960 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | IDE polyclonal antibody (A01), Lot # ABNOVA060711QCS1 Western Blot analysis of IDE expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |