| Brand: | Abnova |
| Reference: | H00003400-M13 |
| Product name: | ID4 monoclonal antibody (M13), clone 3F11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ID4. |
| Clone: | 3F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3400 |
| Gene name: | ID4 |
| Gene alias: | IDB4|bHLHb27 |
| Gene description: | inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
| Genbank accession: | NM_001546.2 |
| Immunogen: | ID4 (NP_001537.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR |
| Protein accession: | NP_001537.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ID4 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |