Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 286,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 286,00 €
Data sheet of ID4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about ID4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003400-A01 |
| Product name: | ID4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ID4. |
| Gene id: | 3400 |
| Gene name: | ID4 |
| Gene alias: | IDB4|bHLHb27 |
| Gene description: | inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
| Genbank accession: | NM_001546 |
| Immunogen: | ID4 (NP_001537, 60 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALET |
| Protein accession: | NP_001537 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ID4 expression in transfected 293T cell line by ID4 polyclonal antibody (A01). Lane1:ID4 transfected lysate(16.622 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |