ID3 (Human) Recombinant Protein (P01) View larger

ID3 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ID3 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ID3 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00003399-P01
Product name: ID3 (Human) Recombinant Protein (P01)
Product description: Human ID3 full-length ORF ( AAH03107, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 3399
Gene name: ID3
Gene alias: HEIR-1|bHLHb25
Gene description: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Genbank accession: BC003107..1
Immunogen sequence/protein sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
Protein accession: AAH03107
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00003399-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: PCB153-Induced Overexpression of ID3 Contributes to the Development of Microvascular Lesions.Das JK, Felty Q
PLoS One. 2014 Aug 4;9(8):e104159. doi: 10.1371/journal.pone.0104159. eCollection 2014.

Reviews

Buy ID3 (Human) Recombinant Protein (P01) now

Add to cart