| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00003399-B01P |
| Product name: | ID3 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ID3 protein. |
| Gene id: | 3399 |
| Gene name: | ID3 |
| Gene alias: | HEIR-1|bHLHb25 |
| Gene description: | inhibitor of DNA binding 3, dominant negative helix-loop-helix protein |
| Genbank accession: | BC003107.1 |
| Immunogen: | ID3 (AAH03107.1, 1 a.a. ~ 119 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH |
| Protein accession: | AAH03107.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ID3 expression in transfected 293T cell line (H00003399-T01) by ID3 MaxPab polyclonal antibody. Lane 1: ID3 transfected lysate(13.09 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |