Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ID3 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about ID3 MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00003399-B01 |
| Product name: | ID3 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ID3 protein. |
| Gene id: | 3399 |
| Gene name: | ID3 |
| Gene alias: | HEIR-1|bHLHb25 |
| Gene description: | inhibitor of DNA binding 3, dominant negative helix-loop-helix protein |
| Genbank accession: | BC003107 |
| Immunogen: | ID3 (AAH03107, 1 a.a. ~ 119 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH |
| Protein accession: | AAH03107 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ID3 expression in transfected 293T cell line (H00003399-T01) by ID3 MaxPab polyclonal antibody. Lane 1: ID3 transfected lysate(13.09 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |