ID3 polyclonal antibody (A01) View larger

ID3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ID3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ID3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003399-A01
Product name: ID3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ID3.
Gene id: 3399
Gene name: ID3
Gene alias: HEIR-1|bHLHb25
Gene description: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Genbank accession: NM_002167
Immunogen: ID3 (NP_002158, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
Protein accession: NP_002158
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003399-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ID3 polyclonal antibody (A01) now

Add to cart