| Brand: | Abnova |
| Reference: | H00003398-M04 |
| Product name: | ID2 monoclonal antibody (M04), clone 2C11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ID2. |
| Clone: | 2C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3398 |
| Gene name: | ID2 |
| Gene alias: | GIG8|ID2A|ID2H|MGC26389|bHLHb26 |
| Gene description: | inhibitor of DNA binding 2, dominant negative helix-loop-helix protein |
| Genbank accession: | BC030639 |
| Immunogen: | ID2 (AAH30639, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG |
| Protein accession: | AAH30639 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.48 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ID2 monoclonal antibody (M04), clone 2C11 Western Blot analysis of ID2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The Transcriptional Repressor ID2 Can Interact with the Canonical Clock Components CLOCK and BMAL1 and Mediate Inhibitory Effects on mPer1 Expression.Ward SM, Fernando SJ, Hou TY, Duffield GE. J Biol Chem. 2010 Dec 10;285(50):38987-9000. Epub 2010 Sep 22. |