| Brand: | Abnova |
| Reference: | H00003398-M01 |
| Product name: | ID2 monoclonal antibody (M01), clone 3C3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ID2. |
| Clone: | 3C3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3398 |
| Gene name: | ID2 |
| Gene alias: | GIG8|ID2A|ID2H|MGC26389|bHLHb26 |
| Gene description: | inhibitor of DNA binding 2, dominant negative helix-loop-helix protein |
| Genbank accession: | BC030639 |
| Immunogen: | ID2 (AAH30639, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG |
| Protein accession: | AAH30639 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.48 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of ID2 over-expressed 293 cell line, cotransfected with ID2 Validated Chimera RNAi ( Cat # H00003398-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ID2 monoclonal antibody (M01), clone 3C3 (Cat # H00003398-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |