No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00003397-M04 |
| Product name: | ID1 monoclonal antibody (M04), clone 4G11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ID1. |
| Clone: | 4G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3397 |
| Gene name: | ID1 |
| Gene alias: | ID|bHLHb24 |
| Gene description: | inhibitor of DNA binding 1, dominant negative helix-loop-helix protein |
| Genbank accession: | BC000613 |
| Immunogen: | ID1 (AAH00613.1, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR |
| Protein accession: | AAH00613.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.79 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to ID1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma.Phi JH, Choi SA, Lim SH, Lee J, Wang KC, Park SH, Kim SK BMC Cancer. 2013 Jun 15;13:291. doi: 10.1186/1471-2407-13-291. |